PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_24967.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family FAR1
Protein Properties Length: 669aa    MW: 76483.2 Da    PI: 6.5676
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_24967.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR199.92.7e-3178165291
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            fYn+YA+++GFs+r+s  ++s+r+g+i++r+ vCs+eg+r+e  ++  +++r+r+ tr+gCka+++vkk+++gkw v+k+ +eHnHel
  evm.TU.contig_24967.4  78 FYNSYARRTGFSTRVSVYQRSRRDGSIICRQIVCSREGFRREGGEN--RSKRQRTITRVGCKAQMTVKKQSSGKWAVSKFAKEHNHEL 163
                            9*****************************************9998..999************************************* PP

                   FAR1  90 ap 91 
                            +p
  evm.TU.contig_24967.4 164 VP 165
                            86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.0E-2878165IPR004330FAR1 DNA binding domain
PROSITE profilePS5096610.336474510IPR007527Zinc finger, SWIM-type
PfamPF044342.6E-10483508IPR007527Zinc finger, SWIM-type
SMARTSM005753.2E-9485512IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MDFEPLSIGN EVDFDSMAED DATTRDLENA DDSDDDFNRE FVEEAPFTAS HFSPSNGGMN  60
LEPYEGMEFD SEQAARIFYN SYARRTGFST RVSVYQRSRR DGSIICRQIV CSREGFRREG  120
GENRSKRQRT ITRVGCKAQM TVKKQSSGKW AVSKFAKEHN HELVPPDKVH CLRSHRHVSG  180
PARSLIDTLQ AAGMGPSGVM SVLIKESGGI NNVGFTKVDC QNYMSSSRQR TLGSGGQVLF  240
DYLNRMQAED PDFFFSVQDQ DRIIRAAVAQ VFPGTRHRFC KWNVFKEAQE KLSDIYRLYP  300
AFELEFQRCI NLTETVEEFE SCWESLHQRY SLSDNEWLQS MYNARQQWVP VYLRDTFFGE  360
MSVNQSSDNI NSYFDGYINA STSIQVLIKQ YEKAIAVRYE KEVRADYDSV NTVPILKTPS  420
PMEKQAANIY TRKVFMKFQE ELVETLAYLA TIIDDTGLEV IYRVAKFGQE HKSHFVRFSM  480
LEKKACCSCQ MFEFSGILCR HILAVFRVTN VLTLPSHYIL KRWTRNAKSG VALDHQTLGL  540
ANNSLESYAA RYDNLGREAI KYIEEGTESI HVFHVAIDAL RVAAKKVAAA KRTDTGIRQN  600
TLLDDNLQLQ TCSTDQDKEI QELTAELENA SQQCEAYRAK LFYVLKDLEE QKLKISVKVQ  660
SVRLNVKD*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073554.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL81e-162FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A0J8BNS90.0A0A0J8BNS9_BETVU; Uncharacterized protein
STRINGPOPTR_0005s27900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-158FAR1-related sequence 5